clean.pdb.RdInspect alternative coordinates, chain breaks, bad residue numbering, non-standard/unknow amino acids, etc. Return a 'clean' pdb object with fixed residue numbering and optionally relabeled chain IDs, corrected amino acid names, removed water, ligand, or hydrogen atoms. All changes are recorded in a log in the returned object.
clean.pdb(pdb, consecutive = TRUE, force.renumber = FALSE, fix.chain = FALSE, fix.aa = FALSE, rm.wat = FALSE, rm.lig = FALSE, rm.h = FALSE, verbose = FALSE)
| pdb | an object of class |
|---|---|
| consecutive | logical, if TRUE renumbering will result in consecutive residue numbers spanning all chains. Otherwise new residue numbers will begin at 1 for each chain. |
| force.renumber | logical, if TRUE atom and residue records are renumbered
even if no 'insert' code is found in the |
| fix.chain | logical, if TRUE chains are relabeled based on chain breaks detected. |
| fix.aa | logical, if TRUE non-standard amino acid names are converted into equivalent standard names. |
| rm.wat | logical, if TRUE water atoms are removed. |
| rm.lig | logical, if TRUE ligand atoms are removed. |
| rm.h | logical, if TRUE hydrogen atoms are removed. |
| verbose | logical, if TRUE details of the conversion process are printed. |
a 'pdb' object with an additional $log component storing
all the processing messages.
call for its effects.
Xin-Qiu Yao & Barry Grant
#> Note: Accessing on-line PDB file#> Warning: /var/folders/xf/qznxnpf91vb1wm4xwgnbt0xr0000gn/T//Rtmp9oBdbc/1a7l.pdb exists. Skipping downloadclean.pdb(pdb)#> #> Call: clean.pdb(pdb = pdb) #> #> Total Models#: 1 #> Total Atoms#: 8750, XYZs#: 26250 Chains#: 6 (values: A B C D E F) #> #> Protein Atoms#: 8634 (residues/Calpha atoms#: 1114) #> Nucleic acid Atoms#: 0 (residues/phosphate atoms#: 0) #> #> Non-protein/nucleic Atoms#: 116 (residues: 54) #> Non-protein/nucleic resid values: [ GLC (6), HOH (48) ] #> #> Protein sequence: #> EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWA #> HDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLP #> NPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGV #> DNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING...<cut>...KDGS #> #> + attr: atom, xyz, seqres, helix, sheet, #> calpha, remark, call, log# }